Peptune IGF-1 LR3
An engineered IGF-1 analogue with an N-terminal extension and an arginine substitution, for growth-factor research.
$79.00
In stock
- Class
- IGF-1 analogue
- Amount per vial
- 1 mg
- Form
- Lyophilized powder
- Length
- 83 residues (IGF-1 is 70)
- Molecular weight
- 9,117.6 g/mol
- Appearance
- White to off-white powder
For laboratory research use only · Certificate of analysis · Full specifications
Documentation
Certificate of analysis
No certificate is published for this product yet. Contact us to check the documentation for the current batch before you order; published certificates are listed in the documentation library.
Overview
About this product
IGF-1 LR3 is a recombinant analogue of insulin-like growth factor 1. It carries a thirteen-residue N-terminal extension and an arginine in place of the glutamic acid at position 3. Together these changes greatly reduce binding to IGF-binding proteins, which is why it is widely used in cell culture, where it stays available to the IGF-1 receptor for longer than native IGF-1. Typical laboratory uses include cell-culture media studies, IGF-1 receptor signalling and comparisons with native IGF-1. Supplied as a lyophilized powder in a sealed vial. What the research shows The studies cited here are in animals. In a 1992 study of rats given dexamethasone, LR3 IGF-1 was approximately 2.5-fold more potent than native IGF-1 on body weight and nitrogen retention, even though it binds the type 1 IGF receptor 3-fold less well; the authors linked this to its weak binding to IGF-binding proteins. A 1997 study in pigs compared IGF-1 with four variants that bind poorly to IGF-binding proteins, including LR3 IGF-1; the variants were 2- to 3-fold more potent than IGF-1 at lowering plasma glucose and suppressed it for longer. Sources: Tomas et al., Biochemical Journal, 1992, PMID 1371669. Tomas et al., Journal of Endocrinology, 1997, PMID 9415072. For laboratory research use only. Not for human or veterinary use. Purity and identity are stated on the batch certificate, published on this page once it is on file.
Research profile
IGF-1 LR3 in the literature
Research areas · 0–5
The molecule
About this compound
IGF-1 LR3 (Long Arg3 IGF-1) is a recombinant analogue of human insulin-like growth factor 1. Mature IGF-1 is 70 residues. LR3 is 83: a 13-residue N-terminal extension (MFPAMPLSSLFVN) is added, and arginine replaces glutamic acid at position 3 of the IGF-1 sequence. Both changes sharply reduce binding to the IGF-binding proteins, so in cell culture the analogue stays available to the IGF-1 receptor far longer than native IGF-1. That is why it is a standard supplement in serum-free media and a common comparator in IGF-1 receptor signalling work. The vial contains 1 mg. The milligrams are the contents of the vial.
- Class
- IGF-1 analogue
- Also known as
- Long R3 IGF-1, LR3-IGF-1
- Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Length
- 83 residues (IGF-1 is 70)
- Modifications
- Arg substituted for Glu at position 3, plus a 13-residue N-terminal extension
- Molecular formula
- C400H625N111O115S9
- Molecular weight
- 9,117.6 g/mol
- Target in the literature
- IGF-1 receptor, with very low affinity for IGF-binding proteins
- Form
- Lyophilized powder
- Amount per vial
- 1 mg
- Appearance
- White to off-white powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Disulfide bonds: Three, as in native IGF-1
- Origin: Recombinant
- Binding proteins: Very low affinity for IGFBPs
Published research
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
- Recombinant expression of IGF-1 and LR3 IGF-1 fused with xylanase in Pichia pastoris.
Applied Microbiology and Biotechnology · 2023 · PMID 37261455
A production paper: expression of LR3 IGF-1 in yeast. It describes the molecule, not a use for this vial.
- IGF-1 LR3 does not promote growth in late-gestation growth-restricted fetal sheep.
American Journal of Physiology — Endocrinology and Metabolism · 2025 · PMID 39679943
A fetal sheep experiment that reported growth measurements. Not a dose, and not evidence this vial is for animal or human use.
For laboratory research use only. Not for human or veterinary use. The amount on the label is the contents of the vial, not a dose.
Ordering in Canada
Buying Peptune IGF-1 LR3 in Canada
- Can I buy Peptune IGF-1 LR3 in Canada?
- Yes. Peptune sells Peptune IGF-1 LR3 online for laboratory research use only, with tracked delivery to every province and territory in Canada.
- How much is Peptune IGF-1 LR3?
- 1 mg: $79, in Canadian dollars. Free shipping on orders of $150 or more.
- Is there a certificate of analysis for Peptune IGF-1 LR3?
- The certificate of analysis for the current batch of Peptune IGF-1 LR3 is published on this page and in the COA library as soon as it is on file.
- How is Peptune IGF-1 LR3 supplied?
- As a lyophilized powder in a sealed vial, labelled with the compound and the amount: 1 mg. The amount is the contents of the vial, not a dose. Keep it sealed, dry, cold and away from light.
- How do I pay?
- By Interac e-Transfer or crypto. The payment instructions arrive by email after you place the order, and nothing is charged before that step.
Verified buyers
Reviews
No reviews yet. Reviews come from verified buyers only, and each one is checked before it appears.
Bought this? Write a review
Loading…
