The compounds, in plain language
A peptide is a short chain of amino acids. NAD+ in this catalogue is a coenzyme, not a peptide. Each note is the molecule, the amount in the vial, and the papers that describe it. Peptune does not publish a dose, a route of administration, or an effect.
Research categories
Grouped by compound class. The name describes the molecule, not an effect.
- Research blendsMore than one sequence, one vial.
- Copper tripeptideThe copper complex of a three-residue peptide.
- GHRH-related sequencesAnalogues of growth hormone-releasing hormone, and a secretagogue.
- Longer peptide analoguesSynthetic sequences of 39 residues.
- HeptapeptidesSequences of seven residues.
- Other single compoundsA growth factor analogue, a mitochondrial peptide and a coenzyme.
The compounds
What each vial is. The milligrams are the contents of the vial. This table does not state a dose, a route of administration, or an effect.
| Compound | Class | Length | In the vial | Form |
|---|---|---|---|---|
| BPC-157 + TB-500 | Two-peptide blend | BPC-157: 15 residues | 10 mg BPC-157 and 10 mg TB-500 | Lyophilized powder |
| CJC-1295 + Ipamorelin | Two-peptide blend | Ipamorelin: 5 residues | 5 mg + 5 mg | Lyophilized powder |
| GHK-Cu | Copper tripeptide | 3 residues | 50 mg | Lyophilized powder |
| GLOW | Research blend | — | 70 mg total | Lyophilized powder |
| IGF-1 LR3 | IGF-1 analogue | 83 residues (IGF-1 is 70) | 1 mg | Lyophilized powder |
| Ipamorelin | Pentapeptide | 5 residues | 10 mg | Lyophilized powder |
| KLOW | Research blend | — | 80 mg total | Lyophilized powder |
| MOTS-c | Mitochondrial peptide | 16 residues | 10 mg | Lyophilized powder |
| NAD+ | Coenzyme, not a peptide | — | 500 mg | Lyophilized powder |
| Retatrutide | Peptide analogue | 39 residues | 10 mg and 20 mg, sold separately | Lyophilized powder |
| Selank | Heptapeptide | 7 residues | 10 mg | Lyophilized powder |
| Semax | Heptapeptide | 7 residues | 10 mg | Lyophilized powder |
| Tesamorelin | Synthetic analogue of growth hormone-releasing hormone | 44 residues | 10 mg | Lyophilized powder |
| Tirzepatide | Peptide analogue | 39 residues | 30 mg | Lyophilized powder |
Notes on each vial
Research blends
BPC-157 + TB-500
One vial holds two synthetic peptides. The label reads 10 mg of BPC-157 and 10 mg of TB-500. Those figures are the contents of this vial. BPC-157 is a pentadecapeptide, fifteen residues, sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val, a fragment of a larger gastric protein sequence in the research literature. TB-500 is the name used for a synthetic fragment related to thymosin beta-4. Commercial use of that name is not uniform, so the lot certificate is the identity record for the fragment in the vial.
- Class
- Two-peptide blend
- Also known as
- BPC-157: Body Protection Compound-157, PL 14736
- CAS number
- BPC-157 137525-51-0; TB-500 885340-08-9 (acetylated 17–23 fragment, Ac-LKKTETQ), 77591-33-4 (full thymosin beta-4)
- Sequence
- BPC-157: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val
- Length
- BPC-157: 15 residues
- Molecular formula
- BPC-157 C62H98N16O22; TB-500 fragment C38H68N10O14
- Molecular weight
- BPC-157 1,419.5 g/mol; TB-500 fragment 889.0 g/mol
- Target in the literature
- BPC-157: fragment of a gastric protein sequence, no single receptor identified. TB-500: fragment related to thymosin beta-4, an actin-binding protein
- Half-life (published)
- BPC-157: under 30 minutes in rats and dogs (PMID 36588717)
- Form
- Lyophilized powder
- Amount per vial
- 10 mg BPC-157 and 10 mg TB-500
- Appearance
- White powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- TB-500: synthetic fragment related to thymosin beta-4
- The beneficial effect of BPC 157, a 15 amino acid peptide BPC fragment, on gastric and duodenal lesions induced by restraint stress, cysteamine and 96% ethanol in rats. Life Sciences, 1994.
- The promoting effect of pentadecapeptide BPC 157 on tendon healing involves tendon outgrowth, cell survival, and cell migration. Journal of Applied Physiology, 2011.
- Subcellular distribution of thymosin beta4. Annals of the New York Academy of Sciences, 2007.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View BPC-157 + TB-500 →CJC-1295 + Ipamorelin
The label names two peptides in one vial: CJC-1295 at 5 mg and ipamorelin at 5 mg. CJC-1295 is a synthetic analogue of growth hormone-releasing hormone. This is the form without DAC (modified GRF 1–29). Ipamorelin is a synthetic pentapeptide, described in the 1998 paper as Aib-His-D-2-Nal-D-Phe-Lys-NH2. Supplier pages sometimes describe a no-DAC analogue at 10 mg, or a different split of the two peptides. Peptune's label is 5 mg and 5 mg.
- Class
- Two-peptide blend
- Also known as
- CJC-1295: Modified GRF (1–29), CJC-1295 without DAC
- CAS number
- CJC-1295 863288-34-0; ipamorelin 170851-70-4
- Sequence
- Ipamorelin: Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Length
- Ipamorelin: 5 residues
- Molecular formula
- CJC-1295 C152H252N44O42; ipamorelin C38H49N9O5
- Molecular weight
- CJC-1295 3,367.9 g/mol; ipamorelin 711.9 g/mol
- Target in the literature
- CJC-1295: GHRH receptor (GHRH analogue). Ipamorelin: ghrelin receptor, GHS-R1a
- Half-life (published)
- Ipamorelin: about 2 hours in people (PMID 10496658)
- Form
- Lyophilized powder
- Amount per vial
- 5 mg + 5 mg
- Appearance
- White powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- CJC-1295: synthetic GHRH analogue without DAC (modified GRF 1–29), 5 mg
- Ipamorelin, the first selective growth hormone secretagogue. European Journal of Endocrinology, 1998.
- Advances in the detection of growth hormone releasing hormone synthetic analogs. Drug Testing and Analysis, 2021.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View CJC-1295 + Ipamorelin →GLOW
GLOW is a multi-peptide research blend in one lyophilized vial. Peptune's label states 70 mg as the total contents. It does not print an internal ratio. Supplier literature that uses this blend name lists a nominal mass split of 50 mg GHK-Cu, 10 mg TB-500 and 10 mg BPC-157 (70 mg altogether). That split is the supplier's nominal formulation, not a measured assay of a Peptune lot, and it is not a molar ratio. A certificate of analysis, when one is on file, is the record for the lot in hand. A paper on one of the named peptides is not a result for the blend.
- Class
- Research blend
- CAS number
- GHK-Cu 89030-95-5, BPC-157 137525-51-0, TB-500 885340-08-9
- Target in the literature
- GHK-Cu: copper(II)-binding tripeptide. BPC-157: gastric protein fragment. TB-500: thymosin beta-4 fragment
- Form
- Lyophilized powder
- Amount per vial
- 70 mg total
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Supplier's nominal split: 50 mg GHK-Cu, 10 mg TB-500, 10 mg BPC-157
- That split is a mass total from supplier literature, not a Peptune lot assay
- GHK Peptide as a Natural Modulator of Multiple Cellular Pathways in Skin Regeneration. BioMed Research International, 2015.
- The promoting effect of pentadecapeptide BPC 157 on tendon healing involves tendon outgrowth, cell survival, and cell migration. Journal of Applied Physiology, 2011.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View GLOW →KLOW
KLOW is a multi-peptide research blend in one lyophilized vial. Peptune's label states 80 mg as the total contents. It does not print an internal ratio. Supplier literature that uses this blend name lists a nominal mass split of 50 mg GHK-Cu, 10 mg BPC-157, 10 mg TB-500 and 10 mg KPV, adding to 80 mg. That literature states the split is mass, not moles, and that the figures are nominal formulation values rather than a measured concentration for a given lot. KPV in that literature is the tripeptide Lys-Pro-Val, the C-terminal tripeptide of alpha-melanocyte-stimulating hormone. A paper on one component is not a result for the blend.
- Class
- Research blend
- CAS number
- GHK-Cu 89030-95-5, BPC-157 137525-51-0, TB-500 885340-08-9, KPV 67727-97-3
- Sequence
- KPV: Lys-Pro-Val
- Molecular formula
- KPV C16H30N4O4
- Molecular weight
- KPV 342.4 g/mol
- Target in the literature
- GHK-Cu: copper(II)-binding tripeptide. BPC-157: gastric protein fragment. TB-500: thymosin beta-4 fragment. KPV: C-terminal tripeptide of alpha-MSH
- Form
- Lyophilized powder
- Amount per vial
- 80 mg total
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Supplier's nominal split: 50 mg GHK-Cu, 10 mg BPC-157, 10 mg TB-500, 10 mg KPV
- That split is nominal mass from supplier literature, not a Peptune lot assay or a molar ratio
- alpha-Melanocyte-stimulating hormone, MSH 11-13 KPV and adrenocorticotropic hormone signalling in human keratinocyte cells. Journal of Investigative Dermatology, 2004.
- GHK Peptide as a Natural Modulator of Multiple Cellular Pathways in Skin Regeneration. BioMed Research International, 2015.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View KLOW →
Copper tripeptide
GHK-Cu
GHK-Cu is the copper complex of the tripeptide glycyl-L-histidyl-L-lysine. The sequence is Gly-His-Lys. The copper ion is part of the complex, which is why the name carries Cu. The vial contains 50 mg of that complex, as a lyophilized powder. The same identity is how the material is specified in laboratory catalogues: sequence, copper complex, amount, and sealed vial. Peptune does not print a purity percentage on this page.
- Class
- Copper tripeptide
- Also known as
- Copper tripeptide-1, glycyl-L-histidyl-L-lysine copper complex
- CAS number
- 89030-95-5 (copper complex); 49557-75-7 (GHK)
- Sequence
- Glycyl-L-histidyl-L-lysine (Gly-His-Lys)
- Length
- 3 residues
- Molecular formula
- C14H22CuN6O4
- Molecular weight
- 401.9 g/mol
- Target in the literature
- Copper(II)-binding tripeptide
- Form
- Lyophilized powder
- Amount per vial
- 50 mg
- Appearance
- Blue to blue-green powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Complex: Copper-binding tripeptide
- GHK Peptide as a Natural Modulator of Multiple Cellular Pathways in Skin Regeneration. BioMed Research International, 2015.
- The glycyl-l-histidyl-l-lysine-Cu(2+) tripeptide complex attenuates lung inflammation and fibrosis in silicosis by targeting peroxiredoxin 6. Redox Biology, 2024.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View GHK-Cu →
GHRH-related sequences
Ipamorelin
Ipamorelin is a synthetic peptide of five amino acids. The sequence reported with the original description is Aib-His-D-2-Nal-D-Phe-Lys-NH2. The vial contains 10 mg of the lyophilized peptide. In the research literature it is classed as a growth-hormone secretagogue, which is a description of the molecule, not an effect claimed for this vial.
- Class
- Pentapeptide
- Also known as
- NNC 26-0161
- CAS number
- 170851-70-4
- Sequence
- Aib-His-D-2-Nal-D-Phe-Lys-NH2
- Length
- 5 residues
- Molecular formula
- C38H49N9O5
- Molecular weight
- 711.9 g/mol
- Target in the literature
- Ghrelin receptor (GHS-R1a) agonist
- Half-life (published)
- About 2 hours in people (PMID 10496658)
- Form
- Lyophilized powder
- Amount per vial
- 10 mg
- Appearance
- White powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Class in the literature: Growth-hormone secretagogue
- Ipamorelin, the first selective growth hormone secretagogue. European Journal of Endocrinology, 1998.
- Ipamorelin, a new growth-hormone-releasing peptide, induces longitudinal bone growth in rats. Growth Hormone & IGF Research, 1999.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View Ipamorelin →Tesamorelin
Tesamorelin is a synthetic analogue of growth hormone-releasing hormone. It is 44 residues, the length of GHRH(1–44), with a trans-3-hexenoyl group on the N-terminus. The vial contains 10 mg.
- Class
- Synthetic analogue of growth hormone-releasing hormone
- Also known as
- TH9507
- CAS number
- 218949-48-5
- Length
- 44 residues
- Modifications
- N-terminal trans-3-hexenoyl group on the GHRH sequence
- Molecular formula
- C221H366N72O67S
- Molecular weight
- 5,135.9 g/mol
- Target in the literature
- GHRH receptor agonist (full-length GHRH analogue)
- Half-life (published)
- About 26 to 39 minutes in dogs (PMID 15113616)
- Form
- Lyophilized powder
- Amount per vial
- 10 mg
- Appearance
- White powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Tesamorelin. Nature Reviews Drug Discovery, 2011.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View Tesamorelin →
Longer peptide analogues
Retatrutide
Retatrutide is a synthetic peptide of 39 amino acids. In the published literature it is also identified as LY3437943, and it is described as engaging the GLP-1, GIP and glucagon receptors. That is the published description of the molecule. Peptune sells it as a 10 mg vial and a 20 mg vial. Those figures are the contents of each vial. They are not a dose.
- Class
- Peptide analogue
- CAS number
- 2381089-83-2
- Length
- 39 residues
- Molecular formula
- C221H342N46O68
- Molecular weight
- 4,731.3 g/mol
- Target in the literature
- GIP, GLP-1 and glucagon receptor agonist
- Half-life (published)
- About 6 days in people (phase 1b, PMID 36354040)
- Form
- Lyophilized powder
- Amount per vial
- 10 mg and 20 mg, sold separately
- Appearance
- White powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Literature code: LY3437943
- Receptors named in the literature: GLP-1, GIP and glucagon
- Triple-Hormone-Receptor Agonist Retatrutide for Obesity — A Phase 2 Trial. New England Journal of Medicine, 2023.
- Triple hormone receptor agonist retatrutide for metabolic dysfunction-associated steatotic liver disease: a randomized phase 2a trial. Nature Medicine, 2024.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View Retatrutide →Tirzepatide
Tirzepatide is a synthetic peptide of 39 amino acids. In the published literature it is also identified as LY3298176, and it is described as engaging the GIP and GLP-1 receptors. A C20 fatty diacid is part of that published structure. It comes in 10 mg, 20 mg and 30 mg vials, and the figure on the label is the contents of the vial.
- Class
- Peptide analogue
- CAS number
- 2023788-19-2
- Length
- 39 residues
- Molecular formula
- C225H348N48O68
- Molecular weight
- 4,813.5 g/mol
- Target in the literature
- GIP and GLP-1 receptor agonist
- Half-life (published)
- About 5 days in people (phase 1, PMID 34647404)
- Form
- Lyophilized powder
- Amount per vial
- 30 mg
- Appearance
- White powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Literature code: LY3298176
- Receptors named in the literature: GIP and GLP-1
- Tirzepatide versus insulin degludec on liver fat content and abdominal adipose tissue in people with type 2 diabetes (SURPASS-3 MRI). The Lancet Diabetes & Endocrinology, 2022.
- Tirzepatide for Obesity Treatment and Diabetes Prevention. New England Journal of Medicine, 2025.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View Tirzepatide →
Heptapeptides
Selank
Selank is a synthetic peptide of seven amino acids, sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It is an analogue of tuftsin (Thr-Lys-Pro-Arg) with a Pro-Gly-Pro extension. The vial contains 10 mg.
- Class
- Heptapeptide
- Also known as
- Tuftsin analogue, TKPRPGP
- CAS number
- 129954-34-3
- Sequence
- Thr-Lys-Pro-Arg-Pro-Gly-Pro
- Length
- 7 residues
- Molecular formula
- C33H57N11O9
- Molecular weight
- 751.9 g/mol
- Target in the literature
- Synthetic analogue of tuftsin
- Form
- Lyophilized powder
- Amount per vial
- 10 mg
- Appearance
- White powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Related sequence: Tuftsin analogue (Thr-Lys-Pro-Arg plus Pro-Gly-Pro)
- Functional Connectomic Approach to Studying Selank and Semax Effects. Doklady Biological Sciences, 2020.
- Effects of heptapeptide selank on genetically-based and situation-provoked symptoms of depression in behavior in WAG/Rij and Wistar rats, and in BALB/c mice. Zhurnal Vysshei Nervnoi Deiatelnosti Imeni I P Pavlova, 2008.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View Selank →Semax
Semax is a synthetic peptide of seven amino acids, sequence Met-Glu-His-Phe-Pro-Gly-Pro. It is an analogue of the ACTH fragment 4–10, with a Pro-Gly-Pro extension. The vial contains 10 mg.
- Class
- Heptapeptide
- Also known as
- ACTH (4–10) analogue, MEHFPGP
- CAS number
- 80714-61-0
- Sequence
- Met-Glu-His-Phe-Pro-Gly-Pro
- Length
- 7 residues
- Molecular formula
- C37H51N9O10S
- Molecular weight
- 813.9 g/mol
- Target in the literature
- Synthetic analogue of ACTH (4–10)
- Form
- Lyophilized powder
- Amount per vial
- 10 mg
- Appearance
- White powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Related sequence: Analogue of ACTH (4–10)
- Semax, an ACTH(4-10) analogue with nootropic properties, activates dopaminergic and serotoninergic brain systems in rodents. Neurochemical Research, 2005.
- Functional Connectomic Approach to Studying Selank and Semax Effects. Doklady Biological Sciences, 2020.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View Semax →
Other single compounds
IGF-1 LR3
IGF-1 LR3 (Long Arg3 IGF-1) is a recombinant analogue of human insulin-like growth factor 1. Mature IGF-1 is 70 residues. LR3 is 83: a 13-residue N-terminal extension (MFPAMPLSSLFVN) is added, and arginine replaces glutamic acid at position 3 of the IGF-1 sequence. Both changes sharply reduce binding to the IGF-binding proteins, so in cell culture the analogue stays available to the IGF-1 receptor far longer than native IGF-1. That is why it is a standard supplement in serum-free media and a common comparator in IGF-1 receptor signalling work. The vial contains 1 mg. The milligrams are the contents of the vial.
- Class
- IGF-1 analogue
- Also known as
- Long R3 IGF-1, LR3-IGF-1
- Sequence
- MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- Length
- 83 residues (IGF-1 is 70)
- Modifications
- Arg substituted for Glu at position 3, plus a 13-residue N-terminal extension
- Molecular formula
- C400H625N111O115S9
- Molecular weight
- 9,117.6 g/mol
- Target in the literature
- IGF-1 receptor, with very low affinity for IGF-binding proteins
- Form
- Lyophilized powder
- Amount per vial
- 1 mg
- Appearance
- White to off-white powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Disulfide bonds: Three, as in native IGF-1
- Origin: Recombinant
- Binding proteins: Very low affinity for IGFBPs
- Recombinant expression of IGF-1 and LR3 IGF-1 fused with xylanase in Pichia pastoris. Applied Microbiology and Biotechnology, 2023.
- IGF-1 LR3 does not promote growth in late-gestation growth-restricted fetal sheep. American Journal of Physiology — Endocrinology and Metabolism, 2025.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View IGF-1 LR3 →MOTS-c
MOTS-c is a peptide of 16 amino acids encoded in mitochondrial DNA, in the 12S rRNA region, rather than in the cell nucleus. The sequence reported with the original description is Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg. The vial contains 10 mg.
- Class
- Mitochondrial peptide
- Also known as
- Mitochondrial open reading frame of the 12S rRNA type-c
- CAS number
- 1627580-64-6
- Sequence
- Met-Arg-Trp-Gln-Glu-Met-Gly-Tyr-Ile-Phe-Tyr-Pro-Arg-Lys-Leu-Arg
- Length
- 16 residues
- Molecular formula
- C101H152N28O22S2
- Molecular weight
- 2,174.6 g/mol
- Target in the literature
- Mitochondrial-derived peptide studied in AMPK signalling
- Form
- Lyophilized powder
- Amount per vial
- 10 mg
- Appearance
- White powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Encoded in: Mitochondrial 12S rRNA, not the nuclear genome
- The mitochondrial-derived peptide MOTS-c promotes metabolic homeostasis and reduces obesity and insulin resistance. Cell Metabolism, 2015.
- MOTS-c: A promising mitochondrial-derived peptide for therapeutic exploitation. Frontiers in Endocrinology, 2023.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View MOTS-c →NAD+
NAD+ is nicotinamide adenine dinucleotide in the oxidized form. It is a coenzyme, not a peptide and not a chain of amino acids. The molecular formula of the free acid is C21H27N7O14P2. Laboratory work treats it as a redox cofactor: it accepts and donates a hydride in enzyme reactions. The vial contains 500 mg of the lyophilized material. The same handling rules as the peptides apply. The amount on the label is the contents of the vial.
- Class
- Coenzyme, not a peptide
- Also known as
- Beta-nicotinamide adenine dinucleotide, beta-NAD
- CAS number
- 53-84-9
- Molecular formula
- C21H27N7O14P2
- Molecular weight
- 663.4 g/mol
- Target in the literature
- Redox coenzyme and substrate of sirtuins and PARPs
- Form
- Lyophilized powder
- Amount per vial
- 500 mg
- Appearance
- White to off-white powder
- Solubility
- Sterile water or bacteriostatic water
- Storage (unopened)
- −20 °C long term, 2 to 8 °C short term; sealed and away from light
- Storage (in solution)
- 2 to 8 °C, away from light; do not freeze
- Packaging
- Sealed vial
- Notes
- Identity: Nicotinamide adenine dinucleotide, oxidized (NAD+)
- Nicotinamide adenine dinucleotide: beyond a redox coenzyme. Organic & Biomolecular Chemistry, 2007.
These are published papers about the molecule. A paper is not a dose, not medical advice, and not evidence that this vial is for human or veterinary use.
View NAD+ →